SCOP 1.63: Domain d1mg0a1: 1mg0 A:1-174,A:325-374

Lineage for d1mg0a1 (1mg0 A:1-174,A:325-374)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (6 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (5 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (30 PDB entries)

8. Domain d1mg0a1: 1mg0 A:1-174,A:325-374 [79051]
   Other proteins in same PDB: d1mg0a2, d1mg0b2, d1mg0c2, d1mg0d2

Details for d1mg0a1

PDB Entry: 1mg0, 1.8 Å

PDB Description: Horse Liver Alcohol Dehydrogenase Complexed With NAD+ and 2,3-Difluorobenzyl Alcohol

SCOP Domain Sequences for d1mg0a1:

Sequence; same for both SEQRES and ATOM records:

>d1mg0a1 b.35.1.2 (A:1-174,A:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

Timeline for d1mg0a1:

• d1mg0a1 is new in SCOP 1.63
  
• d1mg0a1 appears in SCOP 1.65
  
• d1mg0a1 appears in the current release, SCOPe 2.08