Lineage for d1mczm3 (1mcz M:342-525)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361745Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 1361769Protein Benzoylformate decarboxylase [88756] (1 species)
  7. 1361770Species Pseudomonas putida [TaxId:303] [88757] (10 PDB entries)
    Uniprot P20906
  8. 1361795Domain d1mczm3: 1mcz M:342-525 [78990]
    Other proteins in same PDB: d1mcza1, d1mcza2, d1mczb1, d1mczb2, d1mczc1, d1mczc2, d1mczd1, d1mczd2, d1mcze1, d1mcze2, d1mczf1, d1mczf2, d1mczg1, d1mczg2, d1mczh1, d1mczh2, d1mczi1, d1mczi2, d1mczj1, d1mczj2, d1mczk1, d1mczk2, d1mczl1, d1mczl2, d1mczm1, d1mczm2, d1mczn1, d1mczn2, d1mczo1, d1mczo2, d1mczp1, d1mczp2
    complexed with mg, rmn, tdp

Details for d1mczm3

PDB Entry: 1mcz (more details), 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate
PDB Compounds: (M:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1mczm3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mczm3 c.36.1.9 (M:342-525) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs

SCOPe Domain Coordinates for d1mczm3:

Click to download the PDB-style file with coordinates for d1mczm3.
(The format of our PDB-style files is described here.)

Timeline for d1mczm3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczf1, d1mczf2, d1mczf3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczl1, d1mczl2, d1mczl3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3