SCOP 1.65: Domain d1mb4a1: 1mb4 A:1-132,A:355-369

Lineage for d1mb4a1 (1mb4 A:1-132,A:355-369)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Aspartate beta-semialdehyde dehydrogenase [51813] (2 species)

7. Species Vibrio cholerae [TaxId:666] [82297] (2 PDB entries)

8. Domain d1mb4a1: 1mb4 A:1-132,A:355-369 [78908]
   Other proteins in same PDB: d1mb4a2, d1mb4b2

Details for d1mb4a1

PDB Entry: 1mb4, 1.84 Å

PDB Description: crystal structure of aspartate semialdehyde dehydrogenase from vibrio cholerae with nadp and s-methyl-l-cysteine sulfoxide

SCOP Domain Sequences for d1mb4a1:

Sequence; same for both SEQRES and ATOM records:

>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae}
mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
gihhgtktfvggXaaeplrrtlriilae

Timeline for d1mb4a1:

• d1mb4a1 first appeared in SCOP 1.63
  
• d1mb4a1 appears in SCOP 1.67
  
• d1mb4a1 appears in the current release, SCOPe 2.08