Lineage for d1m7qa_ (1m7q A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262793Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 262794Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 262795Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins)
  6. 262941Protein MAP kinase p38 [56129] (2 species)
  7. 262942Species Human (Homo sapiens) [TaxId:9606] [56130] (10 PDB entries)
  8. 262947Domain d1m7qa_: 1m7q A: [78744]
    complexed with dqo, so4

Details for d1m7qa_

PDB Entry: 1m7q (more details), 2.4 Å

PDB Description: crystal structure of p38 map kinase in complex with a dihydroquinazolinone inhibitor

SCOP Domain Sequences for d1m7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7qa_ d.144.1.1 (A:) MAP kinase p38 {Human (Homo sapiens)}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpp

SCOP Domain Coordinates for d1m7qa_:

Click to download the PDB-style file with coordinates for d1m7qa_.
(The format of our PDB-style files is described here.)

Timeline for d1m7qa_: