Lineage for d1m5jb_ (1m5j B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678829Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 678830Superfamily b.89.1: Cyanovirin-N [51322] (1 family) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
  5. 678831Family b.89.1.1: Cyanovirin-N [51323] (1 protein)
  6. 678832Protein Cyanovirin-N [51324] (1 species)
  7. 678833Species Cyanobacterium (Nostoc ellipsosporum) [TaxId:45916] [51325] (11 PDB entries)
  8. 678839Domain d1m5jb_: 1m5j B: [78650]
    swapped dimer, complexed to a synthetic hexamannoside
    complexed with man, nhe, opm

Details for d1m5jb_

PDB Entry: 1m5j (more details), 2.4 Å

PDB Description: crystal structure of cyanovirin-n complexed to a synthetic hexamannoside
PDB Compounds: (B:) Cyanovirin-N

SCOP Domain Sequences for d1m5jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5jb_ b.89.1.1 (B:) Cyanovirin-N {Cyanobacterium (Nostoc ellipsosporum) [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqpsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

SCOP Domain Coordinates for d1m5jb_:

Click to download the PDB-style file with coordinates for d1m5jb_.
(The format of our PDB-style files is described here.)

Timeline for d1m5jb_: