SCOP 1.75: Domain d1m5jb_: 1m5j B:

Lineage for d1m5jb_ (1m5j B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.89: Cyanovirin-N [51321] (1 superfamily)
   complex fold

4. Superfamily b.89.1: Cyanovirin-N [51322] (1 family)
   duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins

5. Family b.89.1.1: Cyanovirin-N [51323] (1 protein)

6. Protein Cyanovirin-N [51324] (1 species)

7. Species Cyanobacterium (Nostoc ellipsosporum) [TaxId:45916] [51325] (11 PDB entries)

8. Domain d1m5jb_: 1m5j B: [78650]
   swapped dimer, complexed to a synthetic hexamannoside
   complexed with man, nhe, opm

Details for d1m5jb_

PDB Entry: 1m5j, 2.4 Å

PDB Description: crystal structure of cyanovirin-n complexed to a synthetic hexamannoside

PDB Compounds: (B:) Cyanovirin-N

SCOP Domain Sequences for d1m5jb_:

Sequence; same for both SEQRES and ATOM records:

>d1m5jb_ b.89.1.1 (B:) Cyanovirin-N {Cyanobacterium (Nostoc ellipsosporum) [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqpsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

Timeline for d1m5jb_:

• d1m5jb_ first appeared in SCOP 1.63
  
• d1m5jb_ appears in SCOP 1.73
  
• d1m5jb_ does not appear in SCOPe 2.01