SCOPe 2.04: Domain d1m4tc1: 1m4t C:3-268

Lineage for d1m4tc1 (1m4t C:3-268)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein Biosynthetic thiolase [53905] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
   Uniprot P07097

8. Domain d1m4tc1: 1m4t C:3-268 [78621]
   complexed with gol, so4

Details for d1m4tc1

PDB Entry: 1m4t, 1.77 Å

PDB Description: biosynthetic thiolase, cys89 butyrylated

PDB Compounds: (C:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1m4tc1:

Sequence; same for both SEQRES and ATOM records:

>d1m4tc1 c.95.1.1 (C:3-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
psiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpage
gqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsma
phcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavas
qnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvt
agnasglndgaaaallmseaeasrrg

Timeline for d1m4tc1:

• d1m4tc1 first appeared in SCOP 1.63
  
• d1m4tc1 appears in SCOPe 2.03
  
• d1m4tc1 appears in SCOPe 2.05
  
• d1m4tc1 appears in the current release, SCOPe 2.08