Lineage for d1m42a_ (1m42 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 659214Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
  6. 659215Protein Copper resistance protein C (CopC, PcoC) [81970] (2 species)
  7. 659221Species Pseudomonas syringae [TaxId:317] [81971] (5 PDB entries)
  8. 659226Domain d1m42a_: 1m42 A: [78597]

Details for d1m42a_

PDB Entry: 1m42 (more details)

PDB Description: solution structure of apocopc from pseudomonas syringae
PDB Compounds: (A:) copper resistance protein c

SCOP Domain Sequences for d1m42a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m42a_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk

SCOP Domain Coordinates for d1m42a_:

Click to download the PDB-style file with coordinates for d1m42a_.
(The format of our PDB-style files is described here.)

Timeline for d1m42a_: