![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein) |
![]() | Protein Copper resistance protein C (CopC, PcoC) [81970] (2 species) |
![]() | Species Pseudomonas syringae [TaxId:317] [81971] (5 PDB entries) |
![]() | Domain d1m42a_: 1m42 A: [78597] |
PDB Entry: 1m42 (more details)
SCOP Domain Sequences for d1m42a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m42a_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]} hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk
Timeline for d1m42a_: