PDB entry 1m42

View 1m42 on RCSB PDB site
Description: Solution structure of apoCopC from Pseudomonas syringae
Class: metal binding protein
Keywords: cupredoxins, copper trafficking
Deposited on 2002-07-02, released 2002-11-06
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-06, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: copper resistance protein c
  Species: Pseudomonas syringae
  Gene: COPC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12376 (0-101)
  Domains in SCOP 1.73: d1m42a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m42A (A:)
  hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
  gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk