Class b: All beta proteins [48724] (144 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.2: Group II dsDNA viruses VP [49749] (3 families) duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
Family b.121.2.3: Major capsid protein vp54 [82013] (1 protein) |
Protein Major capsid protein vp54 [82014] (1 species) |
Species Paramecium bursaria chorella virus type 1, PBCV-1 [82015] (2 PDB entries) a large, lipid-containing, DNA virus |
Domain d1m3yd2: 1m3y D:222-437 [78586] |
PDB Entry: 1m3y (more details), 2 Å
SCOP Domain Sequences for d1m3yd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3yd2 b.121.2.3 (D:222-437) Major capsid protein vp54 {Paramecium bursaria chorella virus type 1, PBCV-1} lpheylieqlqftgsetatpsattqasqnirlnfnhptkylawnfnnptnygqytalani pgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqdrfatrkgsyfnkvqpyq siggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyktcsidatspaavlgnte tvtantatlltalniyaknynvlrimsgmgglayan
Timeline for d1m3yd2: