Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Methylene-tetrahydromethanopterin dehydrogenase [82303] (1 species) |
Species Methylobacterium extorquens [TaxId:408] [82304] (2 PDB entries) |
Domain d1lu9c1: 1lu9 C:98-288 [78214] Other proteins in same PDB: d1lu9a2, d1lu9b2, d1lu9c2 |
PDB Entry: 1lu9 (more details), 1.9 Å
SCOP Domain Sequences for d1lu9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lu9c1 c.2.1.7 (C:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} gsnttaaagvalvvkaaggsvkgkkavvlagtgpvgmrsaallagegaevvlcgrkldka qaaadsvnkrfkvnvtaaetaddasraeavkgahfvftagaiglellpqaawqnessiei vadynaqpplgiggidatdkgkeyggkrafgalgigglklklhraciaklfessegvfda eeiyklakema
Timeline for d1lu9c1:
View in 3D Domains from other chains: (mouse over for more information) d1lu9a1, d1lu9a2, d1lu9b1, d1lu9b2 |