Lineage for d1lt9d_ (1lt9 D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644538Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2644539Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2644540Protein Fibrinogen alpha chain [88887] (4 species)
  7. 2644549Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 2644570Domain d1lt9d_: 1lt9 D: [78193]
    Other proteins in same PDB: d1lt9b1, d1lt9b2, d1lt9c1, d1lt9c2, d1lt9e1, d1lt9e2, d1lt9f1, d1lt9f2
    coiled-coil region only
    complexed with ca, nag

Details for d1lt9d_

PDB Entry: 1lt9 (more details), 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d
PDB Compounds: (D:) Fibrinogen alpha/alpha-E Chain

SCOPe Domain Sequences for d1lt9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lt9d_ h.1.8.1 (D:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
iqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqvia

SCOPe Domain Coordinates for d1lt9d_:

Click to download the PDB-style file with coordinates for d1lt9d_.
(The format of our PDB-style files is described here.)

Timeline for d1lt9d_: