Lineage for d1ls8a_ (1ls8 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213643Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extention, containing a few short helices, forms a flexible lid for the binding cavity
  5. 213644Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins)
  6. 213645Protein Pheromone binding protein [47569] (1 species)
  7. 213646Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (3 PDB entries)
  8. 213650Domain d1ls8a_: 1ls8 A: [78176]

Details for d1ls8a_

PDB Entry: 1ls8 (more details)

PDB Description: nmr structure of the unliganded bombyx mori pheromone-binding protein at physiological ph

SCOP Domain Sequences for d1ls8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ls8a_ a.39.2.1 (A:) Pheromone binding protein {Silkworm (Bombyx mori)}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavgeilaev

SCOP Domain Coordinates for d1ls8a_:

Click to download the PDB-style file with coordinates for d1ls8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ls8a_: