SCOPe 2.03: Domain d1ll6d1: 1ll6 D:36-292,D:355-427

Lineage for d1ll6d1 (1ll6 D:36-292,D:355-427)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Chitinase 1 [51548] (2 species)

7. Species Fungus (Coccidioides immitis) [TaxId:5501] [51549] (4 PDB entries)

8. Domain d1ll6d1: 1ll6 D:36-292,D:355-427 [78083]
   Other proteins in same PDB: d1ll6a2, d1ll6b2, d1ll6c2, d1ll6d2
   mutant

Details for d1ll6d1

PDB Entry: 1ll6, 2.8 Å

PDB Description: structure of the d169n mutant of c. immitis chitinase 1

PDB Compounds: (D:) chitinase 1

SCOPe Domain Sequences for d1ll6d1:

Sequence; same for both SEQRES and ATOM records:

>d1ll6d1 c.1.8.5 (D:36-292,D:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]}
ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
klmkdlgfdgidinweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
yikagvpankivlgmplXdtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvvn
glggtgkleqrenelsypesvydnlkngmps

Timeline for d1ll6d1:

• d1ll6d1 first appeared in SCOP 1.63
  
• d1ll6d1 appears in SCOPe 2.02
  
• d1ll6d1 appears in SCOPe 2.04
  
• d1ll6d1 appears in the current release, SCOPe 2.08