Lineage for d1lj9a_ (1lj9 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307134Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2307221Protein Transcriptional regulator SlyA [81688] (2 species)
  7. 2307222Species Enterococcus faecalis [TaxId:1351] [81689] (1 PDB entry)
  8. 2307223Domain d1lj9a_: 1lj9 A: [78035]

Details for d1lj9a_

PDB Entry: 1lj9 (more details), 1.6 Å

PDB Description: the crystal structure of the transcriptional regulator slya
PDB Compounds: (A:) Transcriptional regulator slyA

SCOPe Domain Sequences for d1lj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]}
tdilreigmiaraldsisniefkelsltrgqylylvrvcenpgiiqekiaelikvdrtta
araikrleeqgfiyrqedasnkkikriyatekgknvypiivrenqhsnqvalqglsevei
sqladylvrmrknvsedwefvkkg

SCOPe Domain Coordinates for d1lj9a_:

Click to download the PDB-style file with coordinates for d1lj9a_.
(The format of our PDB-style files is described here.)

Timeline for d1lj9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lj9b_