Lineage for d1l7qa1 (1l7q A:352-574)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 293779Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 293780Superfamily b.18.1: Galactose-binding domain-like [49785] (19 families) (S)
  5. 293996Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)
  6. 294003Protein Bacterial cocaine esterase, C-terminal domain [69223] (1 species)
  7. 294004Species Rhodococcus sp. mb1 [TaxId:51612] [69224] (4 PDB entries)
  8. 294008Domain d1l7qa1: 1l7q A:352-574 [77791]
    Other proteins in same PDB: d1l7qa2
    complexed with bez; mutant

Details for d1l7qa1

PDB Entry: 1l7q (more details), 1.76 Å

PDB Description: ser117ala mutant of bacterial cocaine esterase coce

SCOP Domain Sequences for d1l7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7qa1 b.18.1.13 (A:352-574) Bacterial cocaine esterase, C-terminal domain {Rhodococcus sp. mb1}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr

SCOP Domain Coordinates for d1l7qa1:

Click to download the PDB-style file with coordinates for d1l7qa1.
(The format of our PDB-style files is described here.)

Timeline for d1l7qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l7qa2