Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families) conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures |
Family c.23.16.5: A4 beta-galactosidase middle domain [82351] (1 protein) probable non-catalytic branch of the class I GAT family; overall fold is very similar but the active site is not conserved |
Protein A4 beta-galactosidase middle domain [82352] (1 species) |
Species Thermus thermophilus [TaxId:274] [82353] (2 PDB entries) |
Domain d1kwga3: 1kwg A:394-590 [77563] Other proteins in same PDB: d1kwga1, d1kwga2 complexed with act, cl, mpd, zn |
PDB Entry: 1kwg (more details), 1.6 Å
SCOP Domain Sequences for d1kwga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwga3 c.23.16.5 (A:394-590) A4 beta-galactosidase middle domain {Thermus thermophilus} pvaqapvalvfdyeaawiyevqpqgaewsylglvylfysalrrlgldvdvvppgaslrgy afavvpslpivreealeafreaegpvlfgprsgsktetfqipkelppgplqallplkvvr veslppgllevaegalgrfplglwrewveaplkplltfqdgkgalyregrylylaawpsp elagrllsalaaeaglk
Timeline for d1kwga3: