![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.80.7: beta-Roll [51120] (2 families) ![]() superhelix turns are made of two short strands each |
![]() | Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein) duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain |
![]() | Protein Metalloprotease [51122] (4 species) The catalytic N-terminal domain belong to the "zincin" superfamily |
![]() | Species Erwinia chrysanthemi [TaxId:556] [82189] (9 PDB entries) protease C |
![]() | Domain d1k7ga1: 1k7g A:259-479 [77279] Other proteins in same PDB: d1k7ga2 complexed with ca, po4, zn |
PDB Entry: 1k7g (more details), 2 Å
SCOPe Domain Sequences for d1k7ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k7ga1 b.80.7.1 (A:259-479) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} ganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinln egsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadt lyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqe vmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv
Timeline for d1k7ga1: