Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species) |
Species Escherichia coli [TaxId:562] [82358] (2 PDB entries) |
Domain d1k4kc_: 1k4k C: [77256] complexed with xe |
PDB Entry: 1k4k (more details), 2 Å
SCOPe Domain Sequences for d1k4kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4kc_ c.26.1.3 (C:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis atiirerlqngescedllpepvltyinqqglyr
Timeline for d1k4kc_: