Class b: All beta proteins [48724] (126 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) |
Protein Thrombin [50531] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50532] (137 PDB entries) |
Domain d1jmo.1: 1jmo L:,H: [77137] Other proteins in same PDB: d1jmoa_ complex with a heparin cofactor II mutant |
PDB Entry: 1jmo (more details), 2.2 Å
SCOP Domain Sequences for d1jmo.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1jmo.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)} atseyqtffnprtfgsgeadcglrplfekksledkterellesyidgXivegsdaeigms pwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtrye rniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqa gykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykp degkrgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqk vidqfge
Timeline for d1jmo.1: