Lineage for d1jgea2 (1jge A:1-181)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (9 PDB entries)
    Uniprot P03989 25-300
  8. Domain d1jgea2: 1jge A:1-181 [77113]
    Other proteins in same PDB: d1jgea1, d1jgeb1, d1jgeb2

Details for d1jgea2

PDB Entry: 1jge (more details), 2.1 Å

PDB Description: HLA-B*2705 bound to nona-peptide m9
PDB Compounds: (A:) hla class I histocompatibility antigen, b-27 b*2705 alpha chain

SCOPe Domain Sequences for d1jgea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d1jgea2 are not available.

Timeline for d1jgea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jgea1
View in 3D
Domains from other chains:
(mouse over for more information)
d1jgeb1, d1jgeb2