SCOP 1.69: Domain d1j5qa2: 1j5q A:222-437

Lineage for d1j5qa2 (1j5q A:222-437)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (3 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
   trimeric; in the trimers, the domains are arranged around pseudo six-fold axis

5. Family b.121.2.3: Major capsid protein vp54 [82013] (1 protein)

6. Protein Major capsid protein vp54 [82014] (1 species)

7. Species Paramecium bursaria chorella virus type 1, PBCV-1 [82015] (2 PDB entries)
   a large, lipid-containing, DNA virus

8. Domain d1j5qa2: 1j5q A:222-437 [77085]

Details for d1j5qa2

PDB Entry: 1j5q, 2.55 Å

PDB Description: the structure and evolution of the major capsid protein of a large, lipid-containing, dna virus.

SCOP Domain Sequences for d1j5qa2:

Sequence; same for both SEQRES and ATOM records:

>d1j5qa2 b.121.2.3 (A:222-437) Major capsid protein vp54 {Paramecium bursaria chorella virus type 1, PBCV-1}
lpheylieqlqftgsetatpsattqasqnirlnfnhptkylawnfnnptnygqytalani
pgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqdrfatrkgsyfnkvqpyq
siggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyktcsidatspaavlgnte
tvtantatlltalniyaknynvlrimsgmgglayan

Timeline for d1j5qa2:

• d1j5qa2 first appeared in SCOP 1.63
  
• d1j5qa2 appears in SCOP 1.67
  
• d1j5qa2 appears in SCOP 1.71
  
• d1j5qa2 last appears in SCOPe 2.06