Lineage for d1j0jb1 (1j0j B:1-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765406Protein Neopullulanase, N-terminal domain [81960] (1 species)
    homologous to maltogenic amylase
  7. 2765407Species Bacillus stearothermophilus [TaxId:1422] [81961] (4 PDB entries)
  8. 2765413Domain d1j0jb1: 1j0j B:1-123 [77042]
    Other proteins in same PDB: d1j0ja2, d1j0ja3, d1j0jb2, d1j0jb3

Details for d1j0jb1

PDB Entry: 1j0j (more details), 2.8 Å

PDB Description: crystal structure of neopullulanase e357q complex with maltotetraose
PDB Compounds: (B:) neopullulanase

SCOPe Domain Sequences for d1j0jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0jb1 b.1.18.2 (B:1-123) Neopullulanase, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
mrkeaiyhrpadnfayaydsetlhlrlrtkkddidrvellhgdpydwqngawqfqmmpmr
ktgsdelfdywfaevkppyrrlrygfvlysgeeklvytekgfyfevptddtayyfcfpfl
hrv

SCOPe Domain Coordinates for d1j0jb1:

Click to download the PDB-style file with coordinates for d1j0jb1.
(The format of our PDB-style files is described here.)

Timeline for d1j0jb1: