SCOPe 2.08: Domain d1j0ha2: 1j0h A:506-588

Lineage for d1j0ha2 (1j0h A:506-588)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Neopullulanase [82175] (1 species)
   homologous to Maltogenic amylase

7. Species Bacillus stearothermophilus [TaxId:1422] [82176] (4 PDB entries)

8. Domain d1j0ha2: 1j0h A:506-588 [77028]
   Other proteins in same PDB: d1j0ha1, d1j0ha3, d1j0hb1, d1j0hb3
   complexed with ca, cl

Details for d1j0ha2

PDB Entry: 1j0h, 1.9 Å

PDB Description: Crystal structure of Bacillus stearothermophilus neopullulanase

PDB Compounds: (A:) neopullulanase

SCOPe Domain Sequences for d1j0ha2:

Sequence; same for both SEQRES and ATOM records:

>d1j0ha2 b.71.1.1 (A:506-588) Neopullulanase {Bacillus stearothermophilus [TaxId: 1422]}
geisflhaddemnyliykktdgdetvlviinrsdqkadipipldargtwlvnlltgerfa
aeaetlctslppygfvlyaiehw

Timeline for d1j0ha2:

• d1j0ha2 first appeared in SCOP 1.63
  
• d1j0ha2 appears in SCOPe 2.07