Lineage for d1izle_ (1izl E:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 897741Fold i.5: Photosystems [58155] (1 superfamily)
  4. 897742Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 897743Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 897757Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 897795Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 897802Domain d1izle_: 1izl E: [76998]

Details for d1izle_

PDB Entry: 1izl (more details), 3.7 Å

PDB Description: crystal structure of photosystem ii
PDB Compounds: (E:) photosystem II: subunit psbe

SCOP Domain Sequences for d1izle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izle_ i.5.1.1 (E:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
rpfsdiitsvrywvihsitipalfiagwlfvstgl

SCOP Domain Coordinates for d1izle_:

Click to download the PDB-style file with coordinates for d1izle_.
(The format of our PDB-style files is described here.)

Timeline for d1izle_: