Lineage for d1iyjb4 (1iyj B:2732-2760,B:2898-2979)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463510Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
    barrel, closed; n=5, S=10
  6. 463534Protein OB-fold domains of BRCA2 [82099] (2 species)
    duplication: tandem repeat of three OB-fold domains
  7. 463542Species Rat (Rattus norvegicus) [TaxId:10116] [82101] (1 PDB entry)
  8. 463544Domain d1iyjb4: 1iyj B:2732-2760,B:2898-2979 [76951]
    Other proteins in same PDB: d1iyjb1, d1iyjb2, d1iyjd1, d1iyjd2

Details for d1iyjb4

PDB Entry: 1iyj (more details), 3.4 Å

PDB Description: structure of a brca2-dss1 complex

SCOP Domain Sequences for d1iyjb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyjb4 b.40.4.3 (B:2732-2760,B:2898-2979) OB-fold domains of BRCA2 {Rat (Rattus norvegicus)}
plplsslfsdggnvgcvdvivqrvyplqwXvwklrvtsykkreksallsiwrpssdlpsl
ltegqryriyhlsvsksknkfewpsiqltatkrtqyqqlpvssetllqlyqp

SCOP Domain Coordinates for d1iyjb4:

Click to download the PDB-style file with coordinates for d1iyjb4.
(The format of our PDB-style files is described here.)

Timeline for d1iyjb4: