Lineage for d1iyjb1 (1iyj B:2403-2598)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650599Fold a.170: BRCA2 helical domain [81871] (1 superfamily)
    multihelical; contains a 3-helical bundle surrounded by several shorter helices
  4. 650600Superfamily a.170.1: BRCA2 helical domain [81872] (1 family) (S)
  5. 650601Family a.170.1.1: BRCA2 helical domain [81873] (1 protein)
  6. 650602Protein BRCA2 helical domain [81874] (2 species)
  7. 650606Species Rat (Rattus norvegicus) [TaxId:10116] [81876] (1 PDB entry)
  8. 650607Domain d1iyjb1: 1iyj B:2403-2598 [76948]
    Other proteins in same PDB: d1iyjb2, d1iyjb3, d1iyjb4, d1iyjb5, d1iyjd2, d1iyjd3, d1iyjd4, d1iyjd5

Details for d1iyjb1

PDB Entry: 1iyj (more details), 3.4 Å

PDB Description: structure of a brca2-dss1 complex
PDB Compounds: (B:) breast cancer susceptibility

SCOP Domain Sequences for d1iyjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyjb1 a.170.1.1 (B:2403-2598) BRCA2 helical domain {Rat (Rattus norvegicus) [TaxId: 10116]}
fpqfnkdlmsslqnardlqdiriknkerhhlcpqpgslyltksstlprislqaavgdsvp
sacspkqlymygvskacisvnsknaeyfqfaiedhfgkealcagkgfrladggwlipsdd
gkagkeefyralcdtpgvdpklissvwvsnhyrwivwklaamefafpkefanrclnperv
llqlkyrydveidnss

SCOP Domain Coordinates for d1iyjb1:

Click to download the PDB-style file with coordinates for d1iyjb1.
(The format of our PDB-style files is described here.)

Timeline for d1iyjb1: