SCOPe 2.07: Domain d1ixbb2: 1ixb B:91-205

Lineage for d1ixbb2 (1ixb B:91-205)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)

8. Domain d1ixbb2: 1ixb B:91-205 [76906]
   Other proteins in same PDB: d1ixba1, d1ixbb1
   complexed with mh2; mutant

Details for d1ixbb2

PDB Entry: 1ixb, 0.9 Å

PDB Description: crystal structure of the e. coli manganese(ii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1ixbb2:

Sequence; same for both SEQRES and ATOM records:

>d1ixbb2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

Timeline for d1ixbb2:

• d1ixbb2 first appeared in SCOP 1.63
  
• d1ixbb2 appears in SCOPe 2.06
  
• d1ixbb2 appears in the current release, SCOPe 2.08