Lineage for d1iwga3 (1iwg A:567-673)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562499Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family) (S)
    duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold
  5. 2562500Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein)
  6. 2562501Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species)
    PN2 and PC2 subdomains are interrupted by the inserted subdomains DN and DC, respectively
  7. 2562502Species Escherichia coli [TaxId:562] [82696] (7 PDB entries)
  8. 2562509Domain d1iwga3: 1iwg A:567-673 [76876]
    Other proteins in same PDB: d1iwga5, d1iwga6, d1iwga7, d1iwga8

Details for d1iwga3

PDB Entry: 1iwg (more details), 3.5 Å

PDB Description: Crystal structure of Bacterial Multidrug Efflux transporter AcrB
PDB Compounds: (A:) AcrB

SCOPe Domain Sequences for d1iwga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwga3 d.58.44.1 (A:567-673) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli [TaxId: 562]}
edqgvfmtmvqlpagatqertqkvlnevthyyltkeknnvesvfavngfgfagrgqntgi
afvslkdwadrpgeenkveaitmratrafsqikdamvfafnlpaive

SCOPe Domain Coordinates for d1iwga3:

Click to download the PDB-style file with coordinates for d1iwga3.
(The format of our PDB-style files is described here.)

Timeline for d1iwga3: