SCOP 1.65: Domain d1iwga1: 1iwg A:38-134

Lineage for d1iwga1 (1iwg A:38-134)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family)
   duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold

5. Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein)

6. Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species)
   PN2 and PC2 subdomains are interupted by the inserted subdomains DN and DC, respectively

7. Species Escherichia coli [TaxId:562] [82696] (6 PDB entries)

8. Domain d1iwga1: 1iwg A:38-134 [76874]
   Other proteins in same PDB: d1iwga5, d1iwga6, d1iwga7, d1iwga8

Details for d1iwga1

PDB Entry: 1iwg, 3.5 Å

PDB Description: Crystal structure of Bacterial Multidrug Efflux transporter AcrB

SCOP Domain Sequences for d1iwga1:

Sequence; same for both SEQRES and ATOM records:

>d1iwga1 d.58.44.1 (A:38-134) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli}
iappavtisasypgadaktvqdtvtqvieqnmngidnlmymssnsdstgtvqitltfesg
tdadiaqvqvqnklqlampllpqevqqqgvsveksss

Timeline for d1iwga1:

• d1iwga1 first appeared in SCOP 1.63
  
• d1iwga1 appears in SCOP 1.67
  
• d1iwga1 appears in the current release, SCOPe 2.08