Lineage for d1ivob1 (1ivo B:3-162)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577591Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 577632Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 577679Family c.10.2.5: L domain [52071] (4 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 577680Protein EGF receptor extracellular domain [82326] (1 species)
  7. 577681Species Human (Homo sapiens) [TaxId:9606] [82327] (3 PDB entries)
  8. 577690Domain d1ivob1: 1ivo B:3-162 [76849]
    Other proteins in same PDB: d1ivoa3, d1ivoa4, d1ivob3, d1ivob4, d1ivoc_, d1ivod_

Details for d1ivob1

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.

SCOP Domain Sequences for d1ivob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivob1 c.10.2.5 (B:3-162) EGF receptor extracellular domain {Human (Homo sapiens)}
ekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqeva
gyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeilhg
avrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgs

SCOP Domain Coordinates for d1ivob1:

Click to download the PDB-style file with coordinates for d1ivob1.
(The format of our PDB-style files is described here.)

Timeline for d1ivob1: