Lineage for d1iv1e_ (1iv1 E:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258900Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 259035Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 259036Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)
  6. 259037Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species)
  7. 259049Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries)
  8. 259072Domain d1iv1e_: 1iv1 E: [76820]

Details for d1iv1e_

PDB Entry: 1iv1 (more details), 1.65 Å

PDB Description: Structure of 2C-Methyl-D-erythritol-2,4-cyclodiphosphate Synthase

SCOP Domain Sequences for d1iv1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv1e_ d.79.5.1 (E:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus}
rigygedshrleegrplylcgllipspvgalahsdgdaalhaltdallsayglgdigllf
pdtdprwrgersevflrealrlveargakllqaslvltldrpklgphrkalvdslsrllr
lpqdrigltfktseglapshvqaravvlld

SCOP Domain Coordinates for d1iv1e_:

Click to download the PDB-style file with coordinates for d1iv1e_.
(The format of our PDB-style files is described here.)

Timeline for d1iv1e_: