SCOP 1.63: Domain d1iu7a3: 1iu7 A:97-211

Lineage for d1iu7a3 (1iu7 A:97-211)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family)

5. Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (10 PDB entries)

8. Domain d1iu7a3: 1iu7 A:97-211 [76808]
   Other proteins in same PDB: d1iu7a1, d1iu7b1

Details for d1iu7a3

PDB Entry: 1iu7, 1.8 Å

PDB Description: holo form of copper-containing amine oxidase from arthrobacter globiformis

SCOP Domain Sequences for d1iu7a3:

Sequence; same for both SEQRES and ATOM records:

>d1iu7a3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

Timeline for d1iu7a3:

• d1iu7a3 is new in SCOP 1.63
  
• d1iu7a3 appears in SCOP 1.65
  
• d1iu7a3 appears in the current release, SCOPe 2.08