Class b: All beta proteins [48724] (178 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
Species Pyrococcus abyssi [TaxId:29292] [82089] (2 PDB entries) |
Domain d1h64r_: 1h64 R: [76694] |
PDB Entry: 1h64 (more details), 1.9 Å
SCOPe Domain Sequences for d1h64r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h64r_ b.38.1.1 (R:) Archaeal homoheptameric Sm protein {Pyrococcus abyssi [TaxId: 29292]} erpldvihrsldkdvlvilkkgfefrgrligydihlnvvladaemiqdgevvkrygkivi rgdnvlaispt
Timeline for d1h64r_:
View in 3D Domains from other chains: (mouse over for more information) d1h641_, d1h642_, d1h64a_, d1h64b_, d1h64c_, d1h64d_, d1h64e_, d1h64f_, d1h64g_, d1h64h_, d1h64i_, d1h64j_, d1h64k_, d1h64l_, d1h64m_, d1h64n_, d1h64o_, d1h64p_, d1h64q_, d1h64s_, d1h64t_, d1h64u_, d1h64v_, d1h64w_, d1h64x_, d1h64y_, d1h64z_ |