Class a: All alpha proteins [46456] (285 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein) two-domain cytochrome c with novel domain arrangement |
Protein Di-heme cytochrome c SoxA [81678] (1 species) cysteine persulfide(cys sulfane) heme coordination |
Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries) |
Domain d1h31e2: 1h31 E:151-261 [76613] Other proteins in same PDB: d1h31b_, d1h31d_, d1h31f_, d1h31h_ complexed with hec |
PDB Entry: 1h31 (more details), 2.55 Å
SCOPe Domain Sequences for d1h31e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h31e2 a.3.1.8 (E:151-261) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]} idgpaqstwekgreiyytrygqldlscascheqyfdhyiradhlsqgqingfpsyrlkna rlnavhdrfrgcirdtrgvpfavgspefvalelyvasrgnglsvegpsvrn
Timeline for d1h31e2: