Lineage for d1h2ub2 (1h2u B:291-480)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 646987Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 646988Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
    contains three domains of this fold connected with long linkers
  7. 646989Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)
  8. 647012Domain d1h2ub2: 1h2u B:291-480 [76588]
    Other proteins in same PDB: d1h2ux_, d1h2uy_

Details for d1h2ub2

PDB Entry: 1h2u (more details), 2.4 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg
PDB Compounds: (B:) 80 kda nuclear cap binding protein

SCOP Domain Sequences for d1h2ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ub2 a.118.1.14 (B:291-480) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
mfdytddpegpvmpgshsverfvieenlhciikshwkerktcaaqlvsypgknkiplnyh
ivevifaelfqlpapphidvmyttllielcklqpgslpqvlaqatemlymrldtmnttcv
drfinwfshhlsnfqfrwswedwsdclsqdpespkpkfvrevlekcmrlsyhqrildivp
ptfsalcpsn

SCOP Domain Coordinates for d1h2ub2:

Click to download the PDB-style file with coordinates for d1h2ub2.
(The format of our PDB-style files is described here.)

Timeline for d1h2ub2: