Lineage for d1h0la_ (1h0l A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253447Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 253448Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 253449Family d.6.1.1: Prion-like [54099] (2 proteins)
  6. 253450Protein Prion protein domain [54100] (4 species)
  7. 253458Species Human (Homo sapiens) [TaxId:9606] [54103] (16 PDB entries)
  8. 253467Domain d1h0la_: 1h0l A: [76441]
    mutant

Details for d1h0la_

PDB Entry: 1h0l (more details)

PDB Description: human prion protein 121-230 m166c/e221c

SCOP Domain Sequences for d1h0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0la_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens)}
gsvvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpcdeysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcitqyercsqayyqrgs

SCOP Domain Coordinates for d1h0la_:

Click to download the PDB-style file with coordinates for d1h0la_.
(The format of our PDB-style files is described here.)

Timeline for d1h0la_: