Class b: All beta proteins [48724] (165 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (3 families) |
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
Protein Tungsten containing formate dehydrogenase, large subunit [82138] (1 species) |
Species Desulfovibrio gigas [TaxId:879] [82139] (1 PDB entry) |
Domain d1h0ha1: 1h0h A:813-977 [76435] Other proteins in same PDB: d1h0ha2, d1h0hb_, d1h0hk2, d1h0hl_ |
PDB Entry: 1h0h (more details), 1.8 Å
SCOP Domain Sequences for d1h0ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0ha1 b.52.2.2 (A:813-977) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} epmecpviehpfsktlhnptalhfateekavcdprypficstyrvtehwqtglmtrntpw lleaepqmfcemseelatlrgikngdkvilesvrgklwakaiitkrikpfaiqgqqvhmv gipwhygwsfpknggdaaniltpsvgnpntgipetkafmvnvtka
Timeline for d1h0ha1:
View in 3D Domains from other chains: (mouse over for more information) d1h0hb_, d1h0hk1, d1h0hk2, d1h0hl_ |