Class a: All alpha proteins [46456] (171 folds) |
Fold a.168: GEF domain of SopE toxin [81831] (1 superfamily) multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist |
Superfamily a.168.1: GEF domain of SopE toxin [81832] (1 family) |
Family a.168.1.1: GEF domain of SopE toxin [81833] (1 protein) |
Protein GEF domain of SopE toxin [81834] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [81835] (1 PDB entry) |
Domain d1gzsb_: 1gzs B: [76425] Other proteins in same PDB: d1gzsa_, d1gzsc_ |
PDB Entry: 1gzs (more details), 2.3 Å
SCOP Domain Sequences for d1gzsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzsb_ a.168.1.1 (B:) GEF domain of SopE toxin {Salmonella typhimurium} gsltnkvvkdfmlqtlndidirgsaskdpayasqtreailsavysknkdqccnlliskgi niapflqeigeaaknaglpgttkndvftpsgaganpfitplissanskyprmfinqhqqa sfkiyaekiimtevaplfnecamptpqqfqlileniankyiqntp
Timeline for d1gzsb_: