SCOPe 2.04: Domain d1gs0b1: 1gs0 B:209-340

Lineage for d1gs0b1 (1gs0 B:209-340)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)

6. Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [81765] (1 PDB entry)

8. Domain d1gs0b1: 1gs0 B:209-340 [76325]
   Other proteins in same PDB: d1gs0a2, d1gs0b2

Details for d1gs0b1

PDB Entry: 1gs0, 2.8 Å

PDB Description: crystal structure of the catalytic fragment of murine poly (adp-ribose) polymerase-2

PDB Compounds: (B:) poly (ADP-ribose) polymerase-2

SCOPe Domain Sequences for d1gs0b1:

Sequence, based on SEQRES records:

>d1gs0b1 a.41.1.1 (B:209-340) Domain of poly(ADP-ribose) polymerase {Mouse (Mus musculus) [TaxId: 10090]}
qldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcirag
qhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkserq
glehpldqhyrn

Sequence, based on observed residues (ATOM records):

>d1gs0b1 a.41.1.1 (B:209-340) Domain of poly(ADP-ribose) polymerase {Mouse (Mus musculus) [TaxId: 10090]}
qldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcirag
qhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkehpl
dqhyrn

Timeline for d1gs0b1:

• d1gs0b1 first appeared in SCOP 1.63
  
• d1gs0b1 appears in SCOPe 2.03
  
• d1gs0b1 appears in SCOPe 2.05
  
• d1gs0b1 appears in the current release, SCOPe 2.08