Lineage for d1fp4d_ (1fp4 D:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321573Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 321596Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 321621Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the interchain arrangment of domains 1 is similar to the intrachain arrangement of domains 2 and 3
  6. 321661Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the interchain arrangment of domains 1 is similar to the intrachain arrangement of domains 2 and 3
  7. 321662Species Azotobacter vinelandii [TaxId:354] [81397] (10 PDB entries)
  8. 321678Domain d1fp4d_: 1fp4 D: [76190]
    Other proteins in same PDB: d1fp4a_, d1fp4c_
    complexed with ca, cfm, clp, hca; mutant

Details for d1fp4d_

PDB Entry: 1fp4 (more details), 2.5 Å

PDB Description: crystal structure of the alpha-h195q mutant of nitrogenase

SCOP Domain Sequences for d1fp4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp4d_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOP Domain Coordinates for d1fp4d_:

Click to download the PDB-style file with coordinates for d1fp4d_.
(The format of our PDB-style files is described here.)

Timeline for d1fp4d_: