Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (25 PDB entries) |
Domain d1ffna2: 1ffn A:2-181 [76166] Other proteins in same PDB: d1ffna1, d1ffnb_, d1ffnd1, d1ffne_ |
PDB Entry: 1ffn (more details), 2.7 Å
SCOPe Domain Sequences for d1ffna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffna2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
Timeline for d1ffna2:
View in 3D Domains from other chains: (mouse over for more information) d1ffnb_, d1ffnd1, d1ffnd2, d1ffne_ |