Lineage for d1ffna2 (1ffn A:2-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406058Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1406349Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (25 PDB entries)
  8. 1406391Domain d1ffna2: 1ffn A:2-181 [76166]
    Other proteins in same PDB: d1ffna1, d1ffnb_, d1ffnd1, d1ffne_

Details for d1ffna2

PDB Entry: 1ffn (more details), 2.7 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33(c9m)
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1ffna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffna2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d1ffna2:

Click to download the PDB-style file with coordinates for d1ffna2.
(The format of our PDB-style files is described here.)

Timeline for d1ffna2: