SCOPe 2.08: Domain d1ffna1: 1ffn A:182-274

Lineage for d1ffna1 (1ffn A:182-274)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class I MHC, alpha-3 domain [88604] (4 species)
Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
Uniprot P01901 22-299
Domain d1ffna1: 1ffn A:182-274 [76165]
Other proteins in same PDB: d1ffna2, d1ffnb1, d1ffnb2, d1ffnd2, d1ffne1, d1ffne2

Details for d1ffna1

PDB Entry: 1ffn (more details), 2.7 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33(c9m)

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1ffna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffna1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOPe Domain Coordinates for d1ffna1:

Click to download the PDB-style file with coordinates for d1ffna1.
(The format of our PDB-style files is described here.)

Timeline for d1ffna1: