Lineage for d1f1gd_ (1f1g D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2373678Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2373698Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2373705Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)
  8. 2373710Domain d1f1gd_: 1f1g D: [76156]
    complexed with cu, po4, zn

Details for d1f1gd_

PDB Entry: 1f1g (more details), 1.35 Å

PDB Description: crystal structure of yeast cuznsod exposed to nitric oxide
PDB Compounds: (D:) copper-zinc superoxide dismutase

SCOPe Domain Sequences for d1f1gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1gd_ b.1.8.1 (D:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

SCOPe Domain Coordinates for d1f1gd_:

Click to download the PDB-style file with coordinates for d1f1gd_.
(The format of our PDB-style files is described here.)

Timeline for d1f1gd_: