![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) |
![]() | Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries) |
![]() | Domain d1f1gb_: 1f1g B: [76154] |
PDB Entry: 1f1g (more details), 1.35 Å
SCOP Domain Sequences for d1f1gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1gb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae)} vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih agqddlgkgdteeslktgnagprpacgvigltn
Timeline for d1f1gb_: