Lineage for d1zqqa4 (1zqq A:149-335)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880450Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 880451Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 880459Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 880460Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 880461Species Human (Homo sapiens) [TaxId:9606] [81574] (107 PDB entries)
    Uniprot P06746
  8. 880559Domain d1zqqa4: 1zqq A:149-335 [75968]
    Other proteins in same PDB: d1zqqa1, d1zqqa3
    protein/DNA complex; complexed with mn, na

Details for d1zqqa4

PDB Entry: 1zqq (more details), 3.3 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of mncl2 (15 millimolar) and nacl (15 millimolar)
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOP Domain Sequences for d1zqqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zqqa4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOP Domain Coordinates for d1zqqa4:

Click to download the PDB-style file with coordinates for d1zqqa4.
(The format of our PDB-style files is described here.)

Timeline for d1zqqa4: