SCOPe 2.08: Domain d1qcrc2: 1qcr C:261-379

Lineage for d1qcrc2 (1qcr C:261-379)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81643] (19 PDB entries)
   Uniprot P00157

8. Domain d1qcrc2: 1qcr C:261-379 [75931]
   Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_
   complexed with hem

Details for d1qcrc2

PDB Entry: 1qcr, 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

PDB Compounds: (C:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1qcrc2:

Sequence; same for both SEQRES and ATOM records:

>d1qcrc2 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

Timeline for d1qcrc2:

• d1qcrc2 first appeared in SCOP 1.63
  
• d1qcrc2 appears in SCOPe 2.07