SCOPe 2.08: Domain d1kyoc3: 1kyo C:1-261

Lineage for d1kyoc3 (1kyo C:1-261)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81640] (5 PDB entries)

8. Domain d1kyoc3: 1kyo C:1-261 [75905]
   Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc2, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon2, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyou_, d1kyov_, d1kyow_
   complexed with fes, hec, sma

Details for d1kyoc3

PDB Entry: 1kyo, 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1kyoc3:

Sequence; same for both SEQRES and ATOM records:

>d1kyoc3 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
ftltiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
alfvfyspntlghpdnyipgn

Timeline for d1kyoc3:

• d1kyoc3 first appeared in SCOP 1.63
  
• d1kyoc3 appears in SCOPe 2.07