SCOPe 2.07: Domain d1iwob1: 1iwo B:125-239

Lineage for d1iwob1 (1iwo B:125-239)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family)
   a distorted variant of double-helix

5. Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)

6. Protein Calcium ATPase, transduction domain A [81651] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (43 PDB entries)
   Uniprot P04191

8. Domain d1iwob1: 1iwo B:125-239 [75858]
   Other proteins in same PDB: d1iwoa2, d1iwoa3, d1iwoa4, d1iwob2, d1iwob3, d1iwob4
   Structure in the absence of calcium ions
   complexed with tg1

Details for d1iwob1

PDB Entry: 1iwo, 3.1 Å

PDB Description: Crystal structure of the SR Ca2+-ATPase in the absence of Ca2+

PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1iwob1:

Sequence; same for both SEQRES and ATOM records:

>d1iwob1 b.82.7.1 (B:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

Timeline for d1iwob1:

• d1iwob1 first appeared in SCOP 1.63
  
• d1iwob1 appears in SCOPe 2.06
  
• d1iwob1 appears in the current release, SCOPe 2.08