Lineage for d6nseb_ (6nse B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1443752Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1443753Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1443754Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1443755Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1443763Species Cow (Bos taurus) [TaxId:9913] [56517] (82 PDB entries)
    Uniprot P29473 67-482
  8. 1443895Domain d6nseb_: 6nse B: [74647]
    complexed with act, cad, ggb, gol, hem, zn

Details for d6nseb_

PDB Entry: 6nse (more details), 2.35 Å

PDB Description: bovine endothelial nitric oxide synthase, h4b-free, canavanine complex
PDB Compounds: (B:) protein (nitric oxide synthase)

SCOPe Domain Sequences for d6nseb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nseb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d6nseb_:

Click to download the PDB-style file with coordinates for d6nseb_.
(The format of our PDB-style files is described here.)

Timeline for d6nseb_: